DPCfam | MC306079
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 123 ± 16 aa |
| Residues in low-complexity regions (%) | 5.84 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 57.94 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF13385 |
| Sequences matching dominant architecture (%) | 5.56 |
| Average overlap percent | 41.62 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A146X4Z7 | 1674-1795 | 122 | GAEVENGFSLRRYDSGIGEDHASAAASEADLSSSGAAHGPDAVSEALSTLSSEVRGAPPADLKSKNVKDILRSLVSAPSEDLMVD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9DDD5-F1 | 729-789 | 52.76 | 39.71 | View in AlphaFoldDB ↗ |