DPCfam | MC306067
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 88 ± 12 aa |
| Residues in low-complexity regions (%) | 1.72 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 25.01 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF04612 |
| Sequences matching dominant architecture (%) | 2.38 |
| Average overlap percent | 59.06 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| R9VRN6 | 18-107 | 90 | WQKLHALVPPSESVILPQRRAFSPLDFQSQGRQLARWQPAHGGGELVLATGWEGVVETFSLLTASGMQVPAFSLMAGEGALNFTL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P45751-F1 | 65-144 | 86.02 | 73.86 | View in AlphaFoldDB ↗ |