DPCfam | MC306016
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 211 |
|---|---|
| Mean domain length (aa) | 84 ± 12 aa |
| Residues in low-complexity regions (%) | 11.65 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 17.41 |
| Average transmembrane regions | 0.78 |
| Dominant Pfam architecture(s) | PF00069 |
| Sequences matching dominant architecture (%) | 70.89 |
| Average overlap percent | 7.74 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0G3BN67 | 304-402 | 99 | PARLPASLQRDLDAIALMALRKEPVRRYATAEQFGADVLRCLARLPVSARRDGWGYRIRRFLLRHRAAFGMALVGASACAGILVT... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P0A5S5-F1 | 244-285 | 48.28 | 95.48 | View in AlphaFoldDB ↗ |