DPCfam | MC305710
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 479 ± 49 aa |
| Residues in low-complexity regions (%) | 3.99 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 36.33 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF13532 |
| Sequences matching dominant architecture (%) | 74.36 |
| Average overlap percent | 42.0 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1W5CZS8 | 438-928 | 491 | EGDSLLVLDILPPSLNENAFGLLRTEVQWKSMHHRSGDVPRLVAVQGKMDEDGSTPIYRHPADESPPLSPFSPLMEKIRVQVQKS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-U7PSB8-F1 | 96-635 | 99.80 | 84.53 | View in AlphaFoldDB ↗ |