DPCfam | MC304946
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 141 |
|---|---|
| Mean domain length (aa) | 96 ± 16 aa |
| Residues in low-complexity regions (%) | 3.88 |
| Residues in coiled-coil regions (%) | 0.84 |
| Predicted disordered residues (%) | 5.01 |
| Average transmembrane regions | 2.06 |
| Dominant Pfam architecture(s) | PF02109 |
| Sequences matching dominant architecture (%) | 95.49 |
| Average overlap percent | 92.02 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A1D4N5 | 29-105 | 77 | QIAHHVWQQYLTTTPQRTMMLDAFMVFLLFVGAVQFLYCVLAGNYPFNAFLSGFCATVGQFVLTASLRMQTSSEQKG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-U7PU16-F1 | 56-154 | 99.00 | 89.11 | View in AlphaFoldDB ↗ |