DPCfam | MC30494
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 325 ± 34 aa |
| Residues in low-complexity regions (%) | 7.68 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 41.25 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00691 |
| Sequences matching dominant architecture (%) | 81.03 |
| Average overlap percent | 24.73 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A109IMR8 | 52-378 | 327 | LIVGARANNPRPDLPKDVRRLVESAAKGGQEIRIVRLDGEPSIALTATFESNQKNDARNDSKLDDFMKRTLGVVQKLEPKVAEAD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9I4T3-F1 | 73-205 | 43.86 | 80.08 | View in AlphaFoldDB ↗ |