DPCfam | MC30446
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 311 |
|---|---|
| Mean domain length (aa) | 134 ± 18 aa |
| Residues in low-complexity regions (%) | 1.45 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 23.2 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF03865 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 45.38 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| Q1N5Z1 | 250-370 | 121 | LSFGGGRDLDQDSANGSYNYRLGWEVPIGYWLLSTRLTGSDYTQAVSGAVQDFVSSGDSHDEYLSAKYLVNRDNNSKLTTDVELR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q7CGD8-F1 | 258-399 | 99.30 | 95.00 | View in AlphaFoldDB ↗ |