DPCfam | MC303736
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 341 |
|---|---|
| Mean domain length (aa) | 132 ± 14 aa |
| Residues in low-complexity regions (%) | 19.19 |
| Residues in coiled-coil regions (%) | 0.1 |
| Predicted disordered residues (%) | 8.97 |
| Average transmembrane regions | 1.06 |
| Dominant Pfam architecture(s) | PF07219 |
| Sequences matching dominant architecture (%) | 99.63 |
| Average overlap percent | 76.29 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0J8JNQ5 | 2-110 | 109 | IRFILAFFALCCLLAFGSMLAEEKGYVLISVSGWTWEMNLFGFFFVLLIAYIGIKACQIMLRLIFNSKRNFSQWREKKAKQKSLL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8ZKV4-F1 | 2-137 | 98.55 | 84.72 | View in AlphaFoldDB ↗ |