DPCfam | MC303586
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 411 |
|---|---|
| Mean domain length (aa) | 303 ± 31 aa |
| Residues in low-complexity regions (%) | 3.91 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 22.03 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF09839 |
| Sequences matching dominant architecture (%) | 99.34 |
| Average overlap percent | 75.74 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1M5RHT3 | 18-332 | 315 | AVTVADLFIGEVAVGSRSNQDRQLGVRDALAQVLVRNTGDSRILEQDAARAMIRQAESYLLSYGYRSGDDLKLQVRFDAQRIQSQ... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9I512-F1 | 14-306 | 99.03 | 92.56 | View in AlphaFoldDB ↗ |