DPCfam | MC303065
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 2701 |
|---|---|
| Mean domain length (aa) | 146 ± 19 aa |
| Residues in low-complexity regions (%) | 1.5 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 14.18 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF01936 |
| Sequences matching dominant architecture (%) | 89.96 |
| Average overlap percent | 92.44 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1J3E4B1 | 9-154 | 146 | SMAKTSVWWDIENCEVPKGWDAHTIAQNVSSALLKMGYCGPVSISAYGDTSLIPLPVQQALSSTGVTLNHVPAGVKDASDKKILV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9M1Q3-F1 | 22-157 | 97.37 | 93.04 | View in AlphaFoldDB ↗ |