DPCfam | MC303057
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 131 |
|---|---|
| Mean domain length (aa) | 86 ± 13 aa |
| Residues in low-complexity regions (%) | 20.24 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 49.03 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| F1RWH5 | 168-244 | 77 | TKEDIDLIDILWRQDIDLGAGREIFDYSHRQKEQDVDKELQDGAEQEDTWPGEGAEALAQNLLVDGETGESFPAQVL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q5NUA6-F1 | 13-85 | 95.40 | 81.39 | View in AlphaFoldDB ↗ |