DPCfam | MC302882
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 131 |
|---|---|
| Mean domain length (aa) | 149 ± 28 aa |
| Residues in low-complexity regions (%) | 1.92 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 20.29 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF16940 |
| Sequences matching dominant architecture (%) | 5.88 |
| Average overlap percent | 9.08 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| E7GQB1 | 71-193 | 123 | ISADAPLPVVPSNVMLANGEVCHYCGPATFVKTKNVVVGYSGGSRGTSVRIAKGMSVHLGARKAAPIRGDVQERTQGVLSITNKR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q5F9A7-F1 | 25-148 | 87.42 | 90.69 | View in AlphaFoldDB ↗ |