DPCfam | MC302870
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 243 ± 34 aa |
| Residues in low-complexity regions (%) | 2.14 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 10.79 |
| Average transmembrane regions | 0.35 |
| Dominant Pfam architecture(s) | PF12937 |
| Sequences matching dominant architecture (%) | 35.48 |
| Average overlap percent | 15.94 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1E1XGE0 | 4-258 | 255 | LPTELLERILSHVGLQDLLLSCSRVCARWHAVIRSPHFLVQRKRYYRYKSGRCSDAREAVEGLCKAHHMDSVETCLPGLIRYMAS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8NFZ0-F1 | 192-446 | 100.00 | 81.48 | View in AlphaFoldDB ↗ |