DPCfam | MC302285
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 136 ± 19 aa |
| Residues in low-complexity regions (%) | 8.43 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 21.54 |
| Average transmembrane regions | 0.14 |
| Dominant Pfam architecture(s) | PF08082 |
| Sequences matching dominant architecture (%) | 96.67 |
| Average overlap percent | 90.0 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| W4YMW4 | 72-208 | 137 | EKRKFGFVDAQKEDMPPEHVRKIIRDHGDMTNRKFRHDKRVYLGALKYMPHAVLKLMENMPMPWEQIRDVSVLYHITGAISFVNE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A1Z8U0-F1 | 118-261 | 99.29 | 90.71 | View in AlphaFoldDB ↗ |