DPCfam | MC302219
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 65 ± 7 aa |
| Residues in low-complexity regions (%) | 0.0 |
| Residues in coiled-coil regions (%) | 2.83 |
| Predicted disordered residues (%) | 27.74 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| U1IGF5 | 114-198 | 84 | ARTKDAERAKFEGEATAYKASTKSCIAKNTLLVKAGKEMVQRYKDLTIGEIVVSREPMIQQRRVEIQNQLQESQDKFLDQKVNP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9I5M9-F1 | 149-211 | 98.44 | 84.63 | View in AlphaFoldDB ↗ |