DPCfam | MC302191
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 161 |
|---|---|
| Mean domain length (aa) | 62 ± 17 aa |
| Residues in low-complexity regions (%) | 32.84 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 61.67 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF05160 |
| Sequences matching dominant architecture (%) | 95.45 |
| Average overlap percent | 84.31 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A179USX8 | 21-89 | 69 | QTQQQKPAVLEEDDEFEDFPVEDWPQEEAETTGFASGGDTTNHLWEESWDDDDNNEDFSKQLKEELKKV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-D3ZHW9-F1 | 8-63 | 95.16 | 72.82 | View in AlphaFoldDB ↗ |