DPCfam | MC302177
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 89 ± 14 aa |
| Residues in low-complexity regions (%) | 14.25 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 41.26 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| Q9M327 | 8-85 | 78 | VDDAEFWLPTEFLTDDDFLVEKENNSVGIDDSLFPYEPRHGFGTFGSTVKPNTVKEDDEESFLAGLTRQMVMSSLKDD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-I1N2P9-F1 | 1-87 | 98.91 | 58.22 | View in AlphaFoldDB ↗ |