DPCfam | MC302142
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 131 |
|---|---|
| Mean domain length (aa) | 175 ± 14 aa |
| Residues in low-complexity regions (%) | 2.32 |
| Residues in coiled-coil regions (%) | 0.38 |
| Predicted disordered residues (%) | 20.88 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A085M5S2 | 40-190 | 151 | VSLLHRFASKIEKLFDEFLQCDPDLFDDQLMATIPETNDFKILIMELRSHPHVMERIFCVDLLEEDLSEDLYSAAARICMTIAPF... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q80TR8-F1 | 13-185 | 96.70 | 90.91 | View in AlphaFoldDB ↗ |