DPCfam | MC302
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 551 |
|---|---|
| Mean domain length (aa) | 246 ± 33 aa |
| Residues in low-complexity regions (%) | 15.08 |
| Residues in coiled-coil regions (%) | 10.72 |
| Predicted disordered residues (%) | 21.33 |
| Average transmembrane regions | 1.31 |
| Dominant Pfam architecture(s) | PF05461 |
| Sequences matching dominant architecture (%) | 81.27 |
| Average overlap percent | 80.31 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A091E700 | 4-249 | 246 | FAKMRMELQRQIAQLYALADKIDKIHRKCAISNVMTSSTQAVSGVLSILGLALAPVTAGGSLLFSATGMGLGAMAAMTSVATTIL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-B2RT54-F1 | 163-413 | 98.82 | 49.75 | View in AlphaFoldDB ↗ |