DPCfam | MC301926
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 351 |
|---|---|
| Mean domain length (aa) | 285 ± 53 aa |
| Residues in low-complexity regions (%) | 8.33 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 43.68 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| W7IWI5 | 36-345 | 310 | RVDLDQLLPRVVDAAAQAITVTGRITNTGDRNVEQIEARLQRGAVLDTESALRGALNDPQKTDAVNRPQVSSTFQPISDRLDPGE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O05436-F1 | 47-366 | 98.88 | 94.06 | View in AlphaFoldDB ↗ |