DPCfam | MC301454
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 241 |
|---|---|
| Mean domain length (aa) | 321 ± 39 aa |
| Residues in low-complexity regions (%) | 5.02 |
| Residues in coiled-coil regions (%) | 0.06 |
| Predicted disordered residues (%) | 12.38 |
| Average transmembrane regions | 0.3 |
| Dominant Pfam architecture(s) | PF02985 |
| Sequences matching dominant architecture (%) | 1.83 |
| Average overlap percent | 8.36 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0006EB0AE0 | 699-1094 | 396 | GAQPLGVAVIDASVLLFPQIFSRAANKHRQQMLEHFAECIKMSKGGRQEAIQINVYTALLLALRALADTKTSLGQEPVKNVAIEL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8C547-F1 | 771-1097 | 100.00 | 91.58 | View in AlphaFoldDB ↗ |