DPCfam | MC301310
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 60 ± 2 aa |
| Residues in low-complexity regions (%) | 1.56 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 25.6 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00278 |
| Sequences matching dominant architecture (%) | 40.0 |
| Average overlap percent | 17.11 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1F8QCI7 | 130-187 | 58 | AIKYGIGHIVVDNPYELDMMRKIAGKRKVDILLRLSPGIDPHTHAYNTTGTVDSKFGF... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P19572-F1 | 114-173 | 100.00 | 89.37 | View in AlphaFoldDB ↗ |