DPCfam | MC30115
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 67 ± 6 aa |
| Residues in low-complexity regions (%) | 1.32 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 49.03 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00130 |
| Sequences matching dominant architecture (%) | 3.33 |
| Average overlap percent | 72.73 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0007B9DB96 | 1378-1450 | 73 | QHSFFEDGPPPFSPSRLRWLKAINKVRVKLHENINGDHNKHPWAKPGGGGIFGIDSMPDLRKKKSIPLVSEVA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q62768-F1 | 454-520 | 92.00 | 43.26 | View in AlphaFoldDB ↗ |