DPCfam | MC301140
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 373 ± 75 aa |
| Residues in low-complexity regions (%) | 5.55 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 30.75 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF05773 |
| Sequences matching dominant architecture (%) | 2.04 |
| Average overlap percent | 21.16 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0006B0ABE2 | 262-590 | 329 | VCLKLTFPASYPYKAPPTFQFSKRTTVDNNLKTKLIKVLRTTSVQQVKRNRSCLEPCLRQLVATLESCTSDGQDQQNQTSPFHIE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q6PJI9-F1 | 389-752 | 99.74 | 68.98 | View in AlphaFoldDB ↗ |