DPCfam | MC301117
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 140 ± 35 aa |
| Residues in low-complexity regions (%) | 16.79 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 10.41 |
| Average transmembrane regions | 1.42 |
| Dominant Pfam architecture(s) | PF10699 |
| Sequences matching dominant architecture (%) | 3.12 |
| Average overlap percent | 23.62 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI00053C36B5 | 1-177 | 177 | MGGVVGKAANDVGVFIGNAFAAPFKAILGRSCENVCTGPWDLECFIEHFCIPDLAKLLMISALSFLSKSSFFFLLCFFYLLVGIL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0R0JFJ1-F1 | 1-154 | 96.25 | 73.80 | View in AlphaFoldDB ↗ |