DPCfam | MC300934
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 166 ± 24 aa |
| Residues in low-complexity regions (%) | 1.2 |
| Residues in coiled-coil regions (%) | 0.18 |
| Predicted disordered residues (%) | 13.6 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF09195 |
| Sequences matching dominant architecture (%) | 98.46 |
| Average overlap percent | 88.29 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| T0YY81 | 8-169 | 162 | AIRAVDSREHKTKASEEKTMPGAWLYSPPSLNAALKTELKRRGWSSHREKCDYPTEFYEPDYAPTPLKKGAYREMDFVKRKLGVE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q45488-F1 | 1-170 | 98.81 | 96.25 | View in AlphaFoldDB ↗ |