DPCfam | MC300543
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 143 ± 21 aa |
| Residues in low-complexity regions (%) | 0.89 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 31.11 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF10634 |
| Sequences matching dominant architecture (%) | 96.3 |
| Average overlap percent | 90.34 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| Q2W8T1 | 13-172 | 160 | AAALMLSGAAGAAERPIGEVEKGGMKISAVYHQGIVVEPKNELYGPDNADIYLQADVHALKNNPNGFGKGEWLPYVTASYVVTKP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q2YK40-F1 | 22-173 | 99.33 | 96.22 | View in AlphaFoldDB ↗ |