DPCfam | MC300386
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 111 |
|---|---|
| Mean domain length (aa) | 73 ± 7 aa |
| Residues in low-complexity regions (%) | 2.55 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 17.15 |
| Average transmembrane regions | 0.03 |
| Dominant Pfam architecture(s) | PF11095 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 92.65 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| R7UGY5 | 131-207 | 77 | EQQQQRTFLRERFLRLLTSIKDKPTTFLLHNKREVQAKFGASDVDILHLQVNDLETPLGKHKAALLRTSDVIMMDVK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0N4UDJ1-F1 | 20-121 | 95.89 | 72.71 | View in AlphaFoldDB ↗ |