DPCfam | MC300305
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 106 ± 16 aa |
| Residues in low-complexity regions (%) | 1.1 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 20.31 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0003C83BF0 | 153-268 | 116 | SSRLAIIDIAGVLTFFDLDARVTDSTGQQVTGELLKLERKDVWDMKWAKDNPDLFAMMEKTRMYVFRNLDPEEPIQTSGYICNFE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8BND3-F1 | 555-670 | 100.00 | 89.77 | View in AlphaFoldDB ↗ |