DPCfam | MC300050
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 72 ± 12 aa |
| Residues in low-complexity regions (%) | 1.97 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 26.63 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF06832 |
| Sequences matching dominant architecture (%) | 91.43 |
| Average overlap percent | 83.31 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A081Y0S7 | 94-162 | 69 | LVRALPGNNQVTIDLIPEGGFGEKWWFLDGTLVANSKDNEKVALTVTKNGKHRLLVLDESGQIFRINFM... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8ZN47-F1 | 695-769 | 97.50 | 86.88 | View in AlphaFoldDB ↗ |