DPCfam | MC30005
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 301 |
|---|---|
| Mean domain length (aa) | 160 ± 23 aa |
| Residues in low-complexity regions (%) | 2.67 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 23.92 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF04121 |
| Sequences matching dominant architecture (%) | 97.47 |
| Average overlap percent | 28.9 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| B7G183 | 371-518 | 148 | DSKLLRQEGLPETDKDAEILKNALALILAGREEDAQILARDSGAPWRAALWSGGKPQGVVHKPNLATETMDRIPTGNPRRALWKR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A1D6PPH2-F1 | 295-468 | 99.39 | 37.39 | View in AlphaFoldDB ↗ |