DPCfam | MC299976
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 72 ± 6 aa |
| Residues in low-complexity regions (%) | 6.77 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 23.69 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF02985 |
| Sequences matching dominant architecture (%) | 5.0 |
| Average overlap percent | 11.41 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1S4BRU6 | 380-446 | 67 | RTIRSSAALALGKLSALSTRVDPLVGDLLSGVQTSDVGIREATLTALKGVIKHAGGSVSIASRTRVY... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-I1JRU2-F1 | 2323-2394 | 97.33 | 84.59 | View in AlphaFoldDB ↗ |