DPCfam | MC299842
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 212 ± 32 aa |
| Residues in low-complexity regions (%) | 20.58 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 74.63 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00168 |
| Sequences matching dominant architecture (%) | 3.77 |
| Average overlap percent | 37.94 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| H2SAU9 | 314-494 | 181 | QLPQLPPKSSTVEQGAALVAEECVRQLQRKVHSNRGPAVSASSQQDLDRSLKNKQELYKDQRRSSENVSHKSSDSDVSDVSAISR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9EQZ7-F1 | 1079-1293 | 98.69 | 33.46 | View in AlphaFoldDB ↗ |