DPCfam | MC299709
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 202 ± 25 aa |
| Residues in low-complexity regions (%) | 6.56 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 40.74 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF00564 |
| Sequences matching dominant architecture (%) | 1.11 |
| Average overlap percent | 26.87 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| S7PRJ3 | 143-348 | 206 | IEISFDIPIDGASDTVKIRSDVTWTEFLEVIVETMDIRPSEVDDLNLAYRFTTWPKSQCPSVLTKASHLSNLFDLARTDLENPKT... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9M9L2-F1 | 31-92 | 30.05 | 89.29 | View in AlphaFoldDB ↗ |