DPCfam | MC299606
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 161 |
|---|---|
| Mean domain length (aa) | 210 ± 29 aa |
| Residues in low-complexity regions (%) | 2.07 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 25.01 |
| Average transmembrane regions | 0.03 |
| Dominant Pfam architecture(s) | PF00249 |
| Sequences matching dominant architecture (%) | 2.36 |
| Average overlap percent | 20.92 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| E9H8P3 | 36-251 | 216 | EEKRRRAWEQWSADDIAAFFEGLNEFGKDFDAIQNCLYTKNRKKSLVNSTNIKNKDQVRHFYYRTWHKISKYLLPTPDEGKRMHK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q6PG95-F1 | 158-374 | 99.05 | 78.93 | View in AlphaFoldDB ↗ |