DPCfam | MC299305
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 68 ± 4 aa |
| Residues in low-complexity regions (%) | 0.82 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 17.02 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF01963 |
| Sequences matching dominant architecture (%) | 97.37 |
| Average overlap percent | 27.95 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| E7F6V0 | 164-231 | 68 | NWERKRPVWVMLMVNSLTEADIKTRGVPVLDLYLAQEAERMKKQTGAVEKVEEQCSPLNTLDFSQVIF... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P0DJQ9-F1 | 164-231 | 100.00 | 93.89 | View in AlphaFoldDB ↗ |