DPCfam | MC299064
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 132 ± 18 aa |
| Residues in low-complexity regions (%) | 1.67 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 24.41 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00400 |
| Sequences matching dominant architecture (%) | 9.8 |
| Average overlap percent | 0.9 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| G3REQ6 | 65-208 | 144 | ETIYPHLLCSTSVQENKEQSRPFVMGYMNERKEPFYKVLFSGEVSGRITLWHIPDVPVSKFDGSPREIPVTATWTLQDNFDKHDT... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A2R8QHJ3-F1 | 329-447 | 98.45 | 84.99 | View in AlphaFoldDB ↗ |