DPCfam | MC298987
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 141 |
|---|---|
| Mean domain length (aa) | 188 ± 16 aa |
| Residues in low-complexity regions (%) | 4.44 |
| Residues in coiled-coil regions (%) | 0.38 |
| Predicted disordered residues (%) | 16.09 |
| Average transmembrane regions | 0.12 |
| Dominant Pfam architecture(s) | PF16073 |
| Sequences matching dominant architecture (%) | 98.52 |
| Average overlap percent | 54.47 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1E3BAA1 | 12-196 | 185 | LLFGSQSTLTSESISQIRATILQDPALRFLHDVLKDLSLLWTSITNAWPALISLPGETYLIELGRFFQEGGDPPAFSETSNIIWA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-B8M9J9-F1 | 12-210 | 99.49 | 84.08 | View in AlphaFoldDB ↗ |