DPCfam | MC298954
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 88 ± 14 aa |
| Residues in low-complexity regions (%) | 1.47 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 24.51 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF10566 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 32.73 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000590C51A | 306-393 | 88 | MKYTGVWWEMHLGKTTWDMASGRHGATTENVKRYIDFSAKNNIKGVLVEGWNTGWAAEEGGFDFVTPYPDYDLEHVVNYANENGV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-G8JZS4-F1 | 352-436 | 97.59 | 98.73 | View in AlphaFoldDB ↗ |