DPCfam | MC29893
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 59 ± 9 aa |
| Residues in low-complexity regions (%) | 4.3 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 39.55 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF01728 |
| Sequences matching dominant architecture (%) | 2.44 |
| Average overlap percent | 20.22 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0B2UZT8 | 228-300 | 73 | TVNSLQGANRVLVPFVACGDLSGWDSDRTYDLELPALYGTFERQRYVYTPVVQPPTEPAYKKACELRKAAKLD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A8E5E3-F1 | 229-286 | 98.31 | 87.77 | View in AlphaFoldDB ↗ |