DPCfam | MC298879
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 176 ± 17 aa |
| Residues in low-complexity regions (%) | 2.15 |
| Residues in coiled-coil regions (%) | 0.09 |
| Predicted disordered residues (%) | 16.14 |
| Average transmembrane regions | 0.52 |
| Dominant Pfam architecture(s) | PF04082 |
| Sequences matching dominant architecture (%) | 0.99 |
| Average overlap percent | 29.15 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1V6NKZ7 | 556-736 | 181 | IYSVSRILEHVPYRLLYTSAGWMASKKDTEASLEDLKERLRSNPEMSRRTLIYAAQLFRRVRNQRWLEACDPLYVLFATLYIWYF... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A1C1CLS3-F1 | 594-763 | 97.22 | 86.30 | View in AlphaFoldDB ↗ |