DPCfam | MC298776
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 117 ± 11 aa |
| Residues in low-complexity regions (%) | 14.62 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 56.53 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000A28070D | 1049-1160 | 112 | SKAKRRKKREEAEKLPEVSRDLYHSIAADLKERFRATEPAPGAGAAGPWNETPEETEMATATAPGAPDPPGGLGEFTFSFFGPDV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q1LV47-F1 | 966-1084 | 100.00 | 45.57 | View in AlphaFoldDB ↗ |