DPCfam | MC298650
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 131 |
|---|---|
| Mean domain length (aa) | 71 ± 4 aa |
| Residues in low-complexity regions (%) | 1.25 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 20.72 |
| Average transmembrane regions | 0.04 |
| Dominant Pfam architecture(s) | PF05013 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 32.94 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0009EBD584 | 74-141 | 68 | IVASLPHSGTFIPPSIANAFTPLHRTWLRNTDWYLLQVYDFLPELGVTTIAATHSRYVADLNRDPEGL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9HU92-F1 | 9-77 | 97.18 | 98.03 | View in AlphaFoldDB ↗ |