DPCfam | MC298622
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 94 ± 10 aa |
| Residues in low-complexity regions (%) | 1.23 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 26.68 |
| Average transmembrane regions | 0.03 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1D6NUM9 | 786-868 | 83 | EAGEGRIAVYGDSNCLDSSHMVTNCYWLLRKILEFTGNRVKDNVLFSEAAQLKFPVFENIHHPSRRTDVNFSTYSTVVGKELI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q14703-F1 | 837-928 | 97.85 | 85.17 | View in AlphaFoldDB ↗ |