DPCfam | MC298489
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 281 |
|---|---|
| Mean domain length (aa) | 80 ± 2 aa |
| Residues in low-complexity regions (%) | 1.69 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 26.24 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF05088 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 7.07 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1J5IXV3 | 823-903 | 81 | LLALSDNIIEGRSTPPAGMRIAQEDADDPYLVVAADKGTARYSDLANAESLAAGFWLGDAFASGGRFGYDHKSIGITARGA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9HZE0-F1 | 883-961 | 100.00 | 88.34 | View in AlphaFoldDB ↗ |