DPCfam | MC298338
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 97 ± 12 aa |
| Residues in low-complexity regions (%) | 6.88 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 66.72 |
| Average transmembrane regions | 0.1 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0009A2F05D | 743-842 | 100 | GYDPRWMMMPPYMDPRMLQGRPPIDYFPAGVHPSGLMARERSDSGGSGSEPFDRHPTRGTPPIDPKLAWAGDVFPPAEMRPLPSP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q7TPM1-F1 | 681-787 | 97.30 | 40.07 | View in AlphaFoldDB ↗ |