DPCfam | MC298020
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 226 ± 29 aa |
| Residues in low-complexity regions (%) | 13.16 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 27.8 |
| Average transmembrane regions | 0.32 |
| Dominant Pfam architecture(s) | PF12165- PF00628 |
| Sequences matching dominant architecture (%) | 85.71 |
| Average overlap percent | 96.03 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0E0HA09 | 23-200 | 178 | PRSVEDIFKDFRARRTAILRALTHDVEDFYAQCDPEKENLCLYGYANEAWQVALPAEERLFGMMNDLPTVYEVVSGSRQSKERDR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A1D6J7E5-F1 | 12-236 | 96.60 | 78.04 | View in AlphaFoldDB ↗ |