DPCfam | MC297676
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 187 ± 20 aa |
| Residues in low-complexity regions (%) | 2.1 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 9.79 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000873F63F | 8-198 | 191 | LCRFCISTVNKGNFTVIDESIREILRTVSVNLDLENNYKQVMCSACSVKLYSAFGFKSTCLYVEDKIMSYVNPNVSFVDLREVHL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-H0WE89-F1 | 359-387 | 15.26 | 91.64 | View in AlphaFoldDB ↗ |