DPCfam | MC297654
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 154 ± 20 aa |
| Residues in low-complexity regions (%) | 4.95 |
| Residues in coiled-coil regions (%) | 6.12 |
| Predicted disordered residues (%) | 31.99 |
| Average transmembrane regions | 0.29 |
| Dominant Pfam architecture(s) | PF13334- PF01762 |
| Sequences matching dominant architecture (%) | 74.63 |
| Average overlap percent | 57.7 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1D1YT59 | 3-184 | 182 | GRAERKVSGPWILVLCASCFLVGMLFTGRFWGGGPELSRQIISQRRQEQELRVVSEDCVTKKKHGQEKDVMGEVTKTHEAIQSLD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-I1LU50-F1 | 16-191 | 99.39 | 71.46 | View in AlphaFoldDB ↗ |