DPCfam | MC29704
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 801 |
|---|---|
| Mean domain length (aa) | 161 ± 22 aa |
| Residues in low-complexity regions (%) | 2.37 |
| Residues in coiled-coil regions (%) | 0.03 |
| Predicted disordered residues (%) | 23.7 |
| Average transmembrane regions | 0.05 |
| Dominant Pfam architecture(s) | PF00347- PF00347 |
| Sequences matching dominant architecture (%) | 67.63 |
| Average overlap percent | 91.16 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1L3STF5 | 5-177 | 173 | GKKPVPVPQGVTANVDGQTVTAKGPKGELRFVVNDEVLVKMEDGAVAVDPRDQSKLARSKWGMSRTQISNIFSGVKDGFEKRLEI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-C0QQN8-F1 | 7-174 | 100.00 | 93.08 | View in AlphaFoldDB ↗ |